MCT4/SLC16A3 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A10548-20UL
100 ul
£336.00
A10548-100UL
500 ul
£1258.00
A10548-500UL
1000 ul
£2228.00
A10548-1000UL
About this Product
- SKU:
- A10548
- Additional Names:
- MCT 3|MCT 4|MCT-3|MCT-4|MCT3|MCT4|MCT4/SLC16A3
- Application:
- ELISA, IHC-Paraffin, Immunofluorescence, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Lactic acid and pyruvate transport across plasma membranes is catalyzed by members of the proton-linked monocarboxylate transporter (MCT) family, which has been designated solute carrier family-16. Each MCT appears to have slightly different substrate and inhibitor specificities and transport kinetics, which are related to the metabolic requirements of the tissues in which it is found. The MCTs, which include MCT1 (SLC16A1; MIM 600682) and MCT2 (SLC16A7; MIM 603654), are characterized by 12 predicted transmembrane domains (Price et al., 1998 [PubMed 9425115]).
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 49 kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- IRKKPKEPQPEVAAAEEEKLHKPPADSGVDLREVEHFLKAEPEKNGEVVHTPETSV
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A10548
