Exportin 2 (XPO2) Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A1041-5UL
20 ul
£164.00
A1041-20UL
100 ul
£342.00
A1041-100UL
500 ul
£1532.00
A1041-500UL
1000 ul
£2704.00
A1041-1000UL
About this Product
- SKU:
- A1041
- Additional Names:
- CAS|CSE1|Exportin 2 (XPO2)|XPO2
- Application:
- ELISA, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- CSE1L (Chromosome Segregation 1-Like) is located on 20q13.13, and encodes a 971-amino-acid protein. It associates with microtubules and mitotic spindles, and is also considered to have a role in tumor progression. The CSE1L protein includes a nuclear localization signal allowing for transport into the nucleus via the importin-alpha/beta heterodimer. In addition, CSE1L plays roles in cell proliferation and apoptosis.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 105kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse
- Sequence:
- LIGLFELPEDDTIPDEEHFIDIEDTPGYQTAFSQLAFAGKKEHDPVGQMVNNPKIHLAQSLHKLSTACPGRVPSMVSTSLNAEALQYLQGYLQAASVTLL
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A1041
