SLC4A7 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A10271-20UL
100 ul
£336.00
A10271-100UL
500 ul
£1258.00
A10271-500UL
1000 ul
£2228.00
A10271-1000UL
About this Product
- SKU:
- A10271
- Additional Names:
- NBC2|NBC3|NBCN1|SBC2|SLC4A6|SLC4A7
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- This locus encodes a sodium bicarbonate cotransporter. The encoded transmembrane protein appears to transport sodium and bicarbonate ions in a 1:1 ratio, and is thus considered an electroneutral cotransporter. The encoded protein likely plays a critical role in regulation of intracellular pH involved in visual and auditory sensory transmission. Alternatively spliced transcript variants encoding distinct isoforms have been described.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 160kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse
- Sequence:
- KKEKEEAERMLQDDDDTVHLPFEGGSLLQIPVKALKYSPDKPVSVKISFEDEPRKKYVDAETSL
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A10271
