IARS Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A10190-20UL
100 ul
£336.00
A10190-100UL
500 ul
£1258.00
A10190-500UL
1000 ul
£2228.00
A10190-1000UL
About this Product
- SKU:
- A10190
- Additional Names:
- GRIDHH|IARS|ILERS|ILRS|IRS|PRO0785
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAS, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Isoleucine-tRNA synthetase belongs to the class-I aminoacyl-tRNA synthetase family and has been identified as a target of autoantibodies in the autoimmune disease polymyositis/dermatomyositis. Alternatively spliced transcript variants have been found.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 144kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- SAPSLINSSSTLLCQYINLQLLNAKPQECLMGTVGTLLLENPLGQNGLTHQGLLYEAAKVFGLRSRKLKLFLNETQTQEITEDIPVKTLNMKTVYVSVLPTTADF
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A10190
