A Alpha-Smooth Muscle Actin (ACTA2) Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A1011-20UL
100 ul
£336.00
A1011-100UL
500 ul
£1258.00
A1011-500UL
1000 ul
£2228.00
A1011-1000UL
About this Product
- SKU:
- A1011
- Additional Names:
- ACTSA|A Alpha-Smooth Muscle Actin (ACTA2)
- Application:
- Detection/Quantitation, ELISA, IHC-Paraffin, Immunofluorescence, Immunohistochemistry, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- This gene encodes one of six different actin proteins. Actins are highly conserved proteins that are involved in cell motility, structure, integrity, and intercellular signaling. The encoded protein is a smooth muscle actin that is involved in vascular contractility and blood pressure homeostasis. Mutations in this gene cause a variety of vascular diseases, such as thoracic aortic disease, coronary artery disease, stroke, and Moyamoya disease, as well as multisystemic smooth muscle dysfunction syndrome.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 42 kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Non-human Primate, Rat
- Sequence:
- MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQI
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A1011
