SUOX Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A0733-5UL
20 ul
£164.00
A0733-20UL
100 ul
£342.00
A0733-100UL
500 ul
£1532.00
A0733-500UL
1000 ul
£2704.00
A0733-1000UL
About this Product
- SKU:
- A0733
- Additional Names:
- sulfite oxidase|SUOX
- Application:
- ELISA, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- Sulfite oxidase is a homodimeric protein localized to the intermembrane space of mitochondria. Each subunit contains a heme domain and a molybdopterin-binding domain. The enzyme catalyzes the oxidation of sulfite to sulfate, the final reaction in the oxidative degradation of the sulfur amino acids cysteine and methionine. Sulfite oxidase deficiency results in neurological abnormalities which are often fatal at an early age. Alternative splicing results in multiple transcript variants encoding identical proteins.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 60kDa
- Purification:
- Affinity Purified
- Reactivities:
- Rat
- Sequence:
- IWVTLGSEVFDVTEFVDLHPGGPSKLMLAAGGPLEPFWALYAVHNQSHVRELLAQYKIGELNPEDKVAPTVETSDPYADDPVRHPALKVNSQRPFNAEPPP
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A0733
