Tyro3 Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A0730-5UL
20 ul
£164.00
A0730-20UL
100 ul
£342.00
A0730-100UL
500 ul
£1532.00
A0730-500UL
1000 ul
£2704.00
A0730-1000UL
About this Product
- SKU:
- A0730
- Additional Names:
- BYK|Dtk|Etk-2|Rek|RSE|Sky|Tif|Tyro3
- Application:
- ELISA, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- The gene is part of a 3-member transmembrane receptor kinase receptor family with a processed pseudogene distal on chromosome 15. The encoded protein is activated by the products of the growth arrest-specific gene 6 and protein S genes and is involved in controlling cell survival and proliferation, spermatogenesis, immunoregulation and phagocytosis. The encoded protein has also been identified as a cell entry factor for Ebola and Marburg viruses.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 130kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- GQLSVLSASQDPLYINIERAEEPTAGGSLELPGRDQPYSGAGDGSGMGAVGGTPSDCRYILTPGGLAEQPGQAEHQPESPLNETQRLLLLQQGLLPHSSC
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A0730
