MAGE-1/MAGE1A Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A0723-5UL
20 ul
£164.00
A0723-20UL
100 ul
£342.00
A0723-100UL
500 ul
£1532.00
A0723-500UL
1000 ul
£2704.00
A0723-1000UL
About this Product
- SKU:
- A0723
- Additional Names:
- CT1.1|MAGE-1/MAGE1A|MAGE1
- Application:
- ELISA, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 51kda
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse
- Sequence:
- VMIAMEGGHAPEEEIWEELSVMEVYDGREHSAYGEPRKLLTQDLVQEKYLEYRQVPDSDPARYEFLWGPRALAETSYVKVLEYVIKVSARVRFFFPSLREAALREEEEGV
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A0723
