C/EBPB Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A0711-20UL
100 ul
£336.00
A0711-100UL
500 ul
£1258.00
A0711-500UL
1000 ul
£2228.00
A0711-1000UL
About this Product
- SKU:
- A0711
- Additional Names:
- C/EBP-beta|C/EBPB|IL6DBP|NF-IL6|TCF5
- Application:
- ELISA, IHC-Paraffin, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- This intronless gene encodes a transcription factor that contains a basic leucine zipper (bZIP) domain. The encoded protein functions as a homodimer but can also form heterodimers with CCAAT/enhancer-binding proteins alpha, delta, and gamma. Activity of this protein is important in the regulation of genes involved in immune and inflammatory responses, among other processes. The use of alternative in-frame AUG start codons results in multiple protein isoforms, each with distinct biological functions.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 48kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- AELKAEPGFEPADCKRKEEAGAPGGGAGMAAGFPYALRAYLGYQAV
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A0711
