Olig3 Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A0600-5UL
20 ul
£164.00
A0600-20UL
100 ul
£342.00
A0600-100UL
500 ul
£1532.00
A0600-500UL
1000 ul
£2704.00
A0600-1000UL
About this Product
- SKU:
- A0600
- Additional Names:
- Bhlhb7|bHLHe20|Olig3
- Application:
- ELISA, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- Enables sequence-specific double-stranded DNA binding activity. Predicted to be involved in neuron differentiation and regulation of transcription by RNA polymerase II. Predicted to act upstream of or within negative regulation of transcription by RNA polymerase II; spinal cord motor neuron cell fate specification; and spinal cord motor neuron migration. Predicted to be part of chromatin. Predicted to be active in nucleus.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 29kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- HAANSVHPVHPILGGALSSGNASSPLSAASLPAIGTIRPPHSLLKAPSTPPALQLGSGFQHWAGLPCPCTICQMPPPPHLSALSTANMARLSAESKDLLK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A0600
