TJP2 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A0594-20UL
100 ul
£336.00
A0594-100UL
500 ul
£1258.00
A0594-500UL
1000 ul
£2228.00
A0594-1000UL
About this Product
- SKU:
- A0594
- Additional Names:
- C9DUPq21.11|DFNA51|DUP9q21.11|FHCA1|PFIC4|TJP2|X104|ZO2
- Application:
- ELISA, Immunoprecipitation, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- This gene encodes a zonula occluden that is a member of the membrane-associated guanylate kinase homolog family. The encoded protein functions as a component of the tight junction barrier in epithelial and endothelial cells and is necessary for proper assembly of tight junctions. Mutations in this gene have been identified in patients with hypercholanemia, and genomic duplication of a 270 kb region including this gene causes autosomal dominant deafness-51. Alternatively spliced transcripts encoding multiple isoforms have been observed for this gene.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 160kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse
- Sequence:
- RSSEPVQHEESIRKPSPEPRAQMRRAASSDQLRDNSPPPAFKPEPPKAKTQNKEESYDFSKSYEYKSNPSAVAGNETPGASTKGYPPPVAAKPTFGRSILKPSTPIPPQEGEEVGESSEEQDNAPKSVLGKVKIFEKMDHKARLQRMQELQEAQNARIEIAQKHPDIYAVPIKTHKPDPGTPQHTSSRPPEPQKAPSRPYQDTRGSYGSDAEEEEYRQQLSEHSKRGYYGQSARYRDTEL
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A0594
