HSP60/HSPD1 Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A0564-5UL
20 ul
£164.00
A0564-20UL
100 ul
£342.00
A0564-100UL
500 ul
£1532.00
A0564-500UL
1000 ul
£2704.00
A0564-1000UL
About this Product
- SKU:
- A0564
- Additional Names:
- CPN60|GROEL|HLD4|HSP-60|HSP60|HSP60/HSPD1|HSP65|HuCHA60|SPG13
- Application:
- ELISA, IHC-Paraffin, Immunocytochemistry, Immunofluorescence, Immunoprecipitation, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- This gene encodes a member of the chaperonin family. The encoded mitochondrial protein may function as a signaling molecule in the innate immune system. This protein is essential for the folding and assembly of newly imported proteins in the mitochondria. This gene is adjacent to a related family member and the region between the 2 genes functions as a bidirectional promoter. Several pseudogenes have been associated with this gene. Two transcript variants encoding the same protein have been identified for this gene. Mutations associated with this gene cause autosomal recessive spastic paraplegia 13.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence within amino acids 350-450 of human HSP60/HSPD1 (P10809).
- Isotype:
- IgG
- Molecular Weight:
- 60 kda
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Plant, Rat
- Sequence:
- VTKDDAMLLKGKGDKAQIEKRIQEIIEQLDVTTSEYEKEKLNERLAKLSDGVAVLKVGGTSDVEVNEKKDRVTDALNATRAAVEEGIVLGGGCALLRCIPA
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A0564
