Alkaline Phosphatase (ALPL) Rabbit monoclonal antibody
Product Sizes
5 ul
£ POA
A0514-5UL
20 ul
£164.00
A0514-20UL
100 ul
£342.00
A0514-100UL
500 ul
£1532.00
A0514-500UL
1000 ul
£2704.00
A0514-1000UL
About this Product
- SKU:
- A0514
- Additional Names:
- Alkaline Phosphatase (ALPL)|AP-TNAP|APTNAP|HOPS|HPPA|HPPC|HPPI|HPPO|TNALP|TNAP|TNS-ALP|TNSALP
- Application:
- ELISA, IHC-Paraffin, Western Blot
- Clonality:
- Monoclonal
- Extra Details:
- This gene encodes a member of the alkaline phosphatase family of proteins. There are at least four distinct but related alkaline phosphatases: intestinal, placental, placental-like, and liver/bone/kidney (tissue non-specific). The first three are located together on chromosome 2, while the tissue non-specific form is located on chromosome 1. The product of this gene is a membrane bound glycosylated enzyme that is not expressed in any particular tissue and is, therefore, referred to as the tissue-nonspecific form of the enzyme. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the mature enzyme. This enzyme may play a role in bone mineralization. Mutations in this gene have been linked to hypophosphatasia, a disorder that is characterized by hypercalcemia and skeletal defects.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 80kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- MISPFLVLAIGTCLTNSLVPEKEKDPKYWRDQAQETLKYALELQKLNTNVAKNVIMFLGDGMGVSTVTAARILKGQLHHNPGEETRLEMDKFPFVALSKT
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:A0514
