CRM1/XPO1 Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A0299-20UL
100 ul
£336.00
A0299-100UL
500 ul
£1258.00
A0299-500UL
1000 ul
£2228.00
A0299-1000UL
About this Product
- SKU:
- A0299
- Additional Names:
- CRM-1|CRM1|CRM1/XPO1|emb|exp1
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- This cell-cycle-regulated gene encodes a protein that mediates leucine-rich nuclear export signal (NES)-dependent protein transport. The protein specifically inhibits the nuclear export of Rev and U snRNAs. It is involved in the control of several cellular processes by controlling the localization of cyclin B, MPAK, and MAPKAP kinase 2. This protein also regulates NFAT and AP-1.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 123kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse
- Sequence:
- PGNPVNNQIFLQEYVANLLKSAFPHLQDAQVKLFVTGLFSLNQDIPAFKEHLRDFLVQIKEFAGEDTSDLFLEEREIALRQADEEKHKRQMSVPGIFNPHE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A0299
