c-Fos Rabbit polyclonal antibody
Product Sizes
20 ul
£152.00
A0236-20UL
100 ul
£336.00
A0236-100UL
500 ul
£1258.00
A0236-500UL
1000 ul
£2228.00
A0236-1000UL
About this Product
- SKU:
- A0236
- Additional Names:
- AP-1|C-FOS|p55
- Application:
- ELISA, Immunoprecipitation, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation. In some cases, expression of the FOS gene has also been associated with apoptotic cell death.
- Formulation:
- Unmodified
- Host:
- Rabbit
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Isotype:
- IgG
- Molecular Weight:
- 55-60 kDa
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Sequence:
- MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANFIPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKT
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:A0236
