Recombinant Mycobacterium tuberculosis MPT51/MPB51 antigen(mpt51) View gallery SKU: CSB-EP363615MVZ Academic Pricing: Please contact us at info@2bscientific.com for specific academic pricing Application: WB, SDS-PAGE Extra Details: Large sizes are available. Host: E.coli Molecular Weight: 44.5 kDa Protein Details: Tag information:N-terminal 6xHis-SUMO-tagged Purity: Greater than 90% as determined by SDS-PAGE. Sequence: AEPTAKAAPYENLMVPSPSMGRDIPVAFLAGGPHAVYLLDAFNAGPDVSNWVTAGNAMNTLAGKGISVVAPAGGAYSMYTNWEQDGSKQWDTFLSAELPDWLAANRGLAPGGHAAVGAAQGGYGAMALAAFHPDRFGFAGSMSGFLYPSNTTTNGAIAAGMQQFGGVDTNGMWGAPQLGRWKWHDPWVHASLLAQNNTRVWVWSPTNPGASDPAAMIGQAAEAMGNSRMFYNQYRSVGGHNGHFDFPASGDNGWGSWAPQLGAMSGDIVGAIR Shipping Conditions: Blue Ice Source: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) Storage Conditions: Please refer to datasheet Supplier: Cusabio-Flarebio Size: 10ug Download: Price for 10ug £433.00 Qty: Add to order Hi, Rasikh and Valeria here, how can we help you? Chat