Recombinant Mycobacterium tuberculosis Diacylglycerol acyltransferase/mycolyltransferase Ag85B(fbpB) View gallery SKU: CSB-EP314366MVZa0 Academic Pricing: Please contact us at info@2bscientific.com for specific academic pricing Additional Names: 30KDA extracellular protein Acyl-CoA:diacylglycerol acyltransferase Antigen 85 complex B Application: WB, SDS-PAGE Extra Details: Large sizes are available. Host: E.coli Molecular Weight: 36.2 kDa Protein Details: Tag information:N-terminal 6xHis-tagged Purity: Greater than 85% as determined by SDS-PAGE. Sequence: FSRPGLPVEYLQVPSPSMGRDIKVQFQSGGNNSPAVYLLDGLRAQDDYNGWDINTPAFEWYYQSGLSIVMPVGGQSSFYSDWYSPACGKAGCQTYKWETFLTSELPQWLSANRAVKPTGSAAIGLSMAGSSAMILAAYHPQQFIYAGSLSALLDPSQGMGPSLIGLAMGDAGGYKAADMWGPSSDPAWERNDPTQQIPKLVANNTRLWVYCGNGTPNELGGANIPAEFLENFVRSSNLKFQDAYNAAGGHNAVFNFPPNGTHSWEYWGAQLNAMKGDLQSSLGAG Shipping Conditions: Blue Ice Source: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) Storage Conditions: Please refer to datasheet Supplier: Cusabio-Flarebio Size: 10ug Download: Price for 10ug £433.00 Qty: Add to order Hi, Rasikh and Valeria here, how can we help you? Chat