A27L Recombinant Protein (Smallpox virus)
Product Sizes
20 ug
OPCA05409-20UG
100 ug
OPCA05409-100UG
About this Product
- SKU:
- OPCA05409
- Additional Names:
- hypothetical protein|hypothetical protein;VARVgp134.
- Buffer:
- Liquid or Lyophilized powder
- Extra Details:
- Structural protein involved in the envelopment of mature virion (MV) to form the wrapped virion (WV). The wrapping consists of the addition of Golgi membranes to the mature virion. Participates in mature virion (MV) movement within the infected cell. May play an indirect role in MV-cell fusion (By similarity).
- Formulation:
- Liquid or Lyophilized powder
- Immunogen:
- A30L
- Molecular Weight:
- 15.0 kDa
- Purity:
- >90%
- Reactivities:
- Virus
- Sequence:
- MDGTLFPGDDDLAIPATEFFSTKAAKKPEAKREAIVKADGDNNEETLKQRLTNLEKKITNVTTKFEQIEKCCKRNDDVLFRLENHAETLRAAMISLAKKIDVQTGRRPYE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C
- Supplier:
- Aviva Systems Biology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:html_datasheet.php