Non-structural polyprotein?Partial Recombinant Protein (CHIKV)
Product Sizes
20 ug
OPCA04657-20UG
100 ug
OPCA04657-100UG
1 mg
OPCA04657-1MG
About this Product
- SKU:
- OPCA04657
- Additional Names:
- CHIKVgp1;nonstructural polyprotein;Polyprotein nsP1234.|nonstructural polyprotein
- Buffer:
- Liquid or Lyophilized powder
- Extra Details:
- P123 is short-lived polyproteins, accumulating during early stage of infection. It localizes the viral replication complex to the cytoplasmic surface of modified endosomes and lysosomes. By interacting with nsP4, it starts viral genome replication into antigenome. After these early events, P123 is cleaved sequentially into nsP1, nsP2 and nsP3. This sequence of delayed processing would allow correct assembly and membrane association of the RNA polymerase complex (By similarity).
- Formulation:
- Liquid or Lyophilized powder
- Immunogen:
- CHIKVgp1
- Molecular Weight:
- 31.1 kDa
- Purity:
- >85%
- Reactivities:
- Virus
- Sequence:
- DTVLETDIASFDKSQDDSLALTALMLLEDLGVDHSLLDLIEAAFGEISSCHLPTGTRFKFGAMMKSGMFLTLFVNTLLNITIASRVLEDRLTKSACAAFIGDDNIIHGVVSDELMAARCATWMNMEVKIIDAVVSQKAPYFCGGFILHDIVTGTACRVADPLKRLFKLGKPLAAGDEQDEDRRRALADEVVRWQRTGLIDELEKAVYSRYEVQGISVVVMSMATFASSRSNFEKLRGPVVTLYGGPK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C
- Supplier:
- Aviva Systems Biology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:html_datasheet.php
