NSP4 Recombinant Protein
Product Sizes
20 ug
OPCA02190-20UG
100 ug
OPCA02190-100UG
1 mg
OPCA02190-1MG
About this Product
- SKU:
- OPCA02190
- Additional Names:
- assembly protein|NCVP5;NS28.
- Buffer:
- Liquid or Lyophilized powder
- Extra Details:
- Plays an essential role in the virus replication cycle by acting as a viroporin. Creates a pore in the host reticulum endoplasmic and as a consequence releases Ca(2+) in the cytoplasm of infected cell. In turn, high levels of cytoplasmic calcium trigger membrane trafficking and transport of viral ER-associated proteins to viroplasms, sites of viral genome replication and immature particle assembly.
- Formulation:
- Liquid or Lyophilized powder
- Molecular Weight:
- 30.6 kDa
- Purity:
- >90%
- Reactivities:
- Virus
- Sequence:
- PTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLTVQTTGEIDMTKEINQKNVRTLEEWESGKNPYEPREVTAAM
- Shipping Conditions:
- Blue Ice
- Source:
- Rotavirus A
- Storage Conditions:
- -20[o]C
- Supplier:
- Aviva Systems Biology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:html_datasheet.php
