KRAS G12R Protein, Human, Recombinant, AviTag
Product Sizes
0.1 mg
KRAS12R-301-0.1MG
About this Product
- SKU:
- KRAS12R-301
- Application:
- Protein Engineering
- Extra Details:
- Recombinant KRAS G12R protein with the N-terminal AviTag™ peptide and His-tag is produced in E. coli cells. Presence of AviTag™ peptide can be useful for a site-specific biotinylation with BirA enzyme (https://amidbiosciences.com/collections/proteins/products/bira-biotin-ligase). Sequence of recombinant human KRAS G12R protein (amino acids 1 - 185; G12R mutant variant of isoform KRAS4B (UNIPROT: P01116-2)) MTEYKLVVVGARGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAM RDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQ DLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEKMSKDGKKKKKKSKTKC
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -70[o]C
- Supplier:
- Amid Biosciences
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Enzymes
- Manufacturer's Data Sheet:kras-g12r-protein-human-recombinant-avitag
