VEGF164
Product Sizes
2 ug
£147.06
R20-067-2UG
5 ug
£204.71
R20-067-5UG
About this Product
- SKU:
- R20-067
- Additional Names:
- vascular endothelial growth factor A; Vegfa; Vegf; VEGF164
- Buffer:
- PBS
- Extra Details:
- Rat Vascular Endothelial Growth Factor164 (VEGF164), a 19.23 kDa protein consisting of 164 amino acid residues, is produced as a homodimer. VEGF164 is a polypeptide growth factor and a member of the platelet-derived growth factor family. It is a specific mitogen for vascular endothelial cells and a strong angiogenic factor in vivo. Two high-affinity tyrosine kinase receptors for VEGF164 have been identified, VEGFR-1 (FLT-1), and VEGFR-2 (Flk-1). Consistent with the endothelial cell-specific action of VEGF120, expression of both receptor genes has been found predominantly but not exclusively on endothelial cells. Expression of VEGFR-1 was also found on human monocytes, neutrophils (PMNs), bovine brain pericytes and villous and extravillous trophoblasts. In addition to its action as a mitogen it is a potent vascular permeability factor (VPF) in vivo and is also a chemo attractant for monocytes and endothelial cells. At least four different proteins are generated by differential splicing of the mouse VEGF gene: VEGF120, VEGF144, VEGF164 and VEGF188. The most abundant form is VEGF164. Whereas VEGF120, VEGF144 and VEGF164 are secreted proteins, VEGF188 is strongly cell-associated. In addition, the isoforms VEGF164 and VEGF188 bind to heparin with high affinity. All dimeric forms possess similar biological activities. A related protein of VEGF is placenta growth factor (PlGF) with about 53% homology and VEGF-B with similar biological activities. The full ORF of native rat VEGF164 (Ala27-Arg190) was cloned from total RNA of rat sinusoidal endothelial cells using standard protocols
- Formulation:
- lyophilized (freeze-dried)
- Molecular Weight:
- 19.23 kDa
- Purity:
- >95%
- Reactivities:
- Rat
- Sequence:
- APTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPENHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
- Shipping Conditions:
- Ambient
- Storage Conditions:
- -20[o]C reconstituted, working aliquot. Avoid freeze/thaw cycles.
- Supplier:
- ReliaTech
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins