I-TAC (CXCL11)
Product Sizes
1000 ug
£5216.00
M10-086-L1000-1000UG
About this Product
- SKU:
- M10-086-L1000
- Additional Names:
- CXCL11
- Extra Details:
- I-TAC is a "non-ELR" CXC chemokine that is regulated by interferon and signals through the CXCR3 receptor. I-TAC is chemoattractant for IL-2 activated T cells, but does not affect freshly isolated un-stimulated T cells, neutrophils, or monocytes. Recombinant murine I-TAC is a 9.0 kDa protein containing 79 amino acid residues including the four highly conserved cysteine residues present in CXC chemokines.
- Formulation:
- lyophilized
- Molecular Weight:
- 9.0 kDa
- Purity:
- > 98% by SDS-PAGE & HPLC analyses
- Reactivities:
- Bacteria, Human, Mouse, Non-human Primate
- Sequence:
- FLMFKQGRCLCIGPGMKAVKMAEIEKASVIYPSNGCDKVEVIVTMKAHKRQRCLDPRSKQARLIMQAIEKKNFLRRQNM
- Shipping Conditions:
- Blue Ice
- Supplier:
- ReliaTech
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
