Growth Hormone
Product Sizes
10 ug
£278.00
500-022-10UG
50 ug
£405.00
500-022-50UG
About this Product
- SKU:
 - 500-022
 - Additional Names:
 - Somatotropin, GH, GH-N, Growth Hormone 1, Pituitary growth hormone
 - Extra Details:
 - Recombinant zebrafish growth hormone (zbGH) produced in E.Coli (22 K) is a single, non-glycosylated, polypeptide chain containing 185 amino acids with an additional Ala at its N-terminus and having a molecular mass of 21187 Dalton.
 - Formulation:
 - lyophilized
 - Host:
 - E. coli
 - Molecular Weight:
 - 21.1 kDa
 - Purity:
 - > 99.0% as determined by RP-HPLC, Gel filtration and SDS-PAGE Silver Stained gel.
 - Sequence:
 - AQRLFNNAVIRVQHLHQLAAKMINDFEEGLMPEERRQLSKIFPLSFCNSDSIETPTGKDETQKSSMLKLLRISFRLIESWEFPSQTLSSTISNSLTIGNPNQITEKLADLKMGISVLIKGCLDGQPNMDDNDSLPLPFEDFYLTVGETSLRESFRLLACFKKDMHKVETYLRVANCRRSLDSNCTL
 - Shipping Conditions:
 - Ambient
 - Storage Conditions:
 - Room Temperature
 - Supplier:
 - ReliaTech
 - Type:
 - Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
 
