Growth Hormone
Product Sizes
10 ug
£278.00
500-022-10UG
50 ug
£405.00
500-022-50UG
About this Product
- SKU:
- 500-022
- Additional Names:
- Somatotropin, GH, GH-N, Growth Hormone 1, Pituitary growth hormone
- Extra Details:
- Recombinant zebrafish growth hormone (zbGH) produced in E.Coli (22 K) is a single, non-glycosylated, polypeptide chain containing 185 amino acids with an additional Ala at its N-terminus and having a molecular mass of 21187 Dalton.
- Formulation:
- lyophilized
- Host:
- E. coli
- Molecular Weight:
- 21.1 kDa
- Purity:
- > 99.0% as determined by RP-HPLC, Gel filtration and SDS-PAGE Silver Stained gel.
- Sequence:
- AQRLFNNAVIRVQHLHQLAAKMINDFEEGLMPEERRQLSKIFPLSFCNSDSIETPTGKDETQKSSMLKLLRISFRLIESWEFPSQTLSSTISNSLTIGNPNQITEKLADLKMGISVLIKGCLDGQPNMDDNDSLPLPFEDFYLTVGETSLRESFRLLACFKKDMHKVETYLRVANCRRSLDSNCTL
- Shipping Conditions:
- Ambient
- Storage Conditions:
- Room Temperature
- Supplier:
- ReliaTech
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
