Growth Hormone
Product Sizes
20 ug
£303.00
500-012-20UG
100 ug
£534.00
500-012-100UG
About this Product
- SKU:
- 500-012
- Additional Names:
- Somatotropin, GH, GH-N, Growth Hormone 1, Pituitary growth hormone
- Extra Details:
- Recombinant ovine growth hormone, one polypeptide chain containing 191 amino acids and having a molecular mass of ~ 21.8 kDa.
- Formulation:
- lyophilized
- Molecular Weight:
- 21.8 kDA
- Purity:
- > 98.0% as determined by RP-HPLC, Gel filtration and SDS-PAGE Silver Stained gel.
- Sequence:
- AFPAMSLSGLFANAVLRAQHLHQLAADTFKEFERTYIPEGQRYSIQNTQVAFCFSETIPAPTGKNEAQQKSDLELLRISLLLIQSWLGPLQFLSRVFTNSLVFGTSDRVYEKLKDLEEGILALMRELEDVTPRAGQILKQTYDKFDTNMRSDDALLKNYGLLSCFRKDLHKTETYLRVMKCRRFGEASCAF
- Shipping Conditions:
- Ambient
- Supplier:
- ReliaTech
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
