Growth Hormone
Product Sizes
100 ug
£301.18
500-009-100UG
500 ug
£674.12
500-009-500UG
About this Product
- SKU:
- 500-009
- Additional Names:
- Somatotropin, GH, GH-N, Growth Hormone 1, Pituitary growth hormone
- Extra Details:
- Plays an important role in growth control. Its major role in stimulating body growth is to stimulate the liver and other tissues to secrete IGF-1. It stimulates both the differentiation and proliferation of myoblasts. It also stimulates amino acid uptake and protein synthesis in muscle and other tissues.
- Formulation:
- lyophilized
- Host:
- E. coli
- Molecular Weight:
- 21.8 kDa
- Purity:
- > 98.0% as determined by RP-HPLC, Gel filtration and SDS-PAGE Silver Stained gel.
- Reactivities:
- Bovine
- Sequence:
- AFPAMSLSGLFANAVLRAQHLHQLAADTFKEFERTYIPEGQRYSIQNTQVAFCFSETIPAPTGKNEAQQKSDLELLRISLLLIQSWLGPLQFLSRVFTNSLVFGTSDRVYEKLKDLEEGILALMRELEDGTPRAGQILKQTYDKFDTNMRSDDALLKNYGLLSCFRKDLHKTETYLRVMKCRRFGEASCAF
- Shipping Conditions:
- Ambient
- Storage Conditions:
- Room Temperature
- Supplier:
- ReliaTech
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins