PTHrP
Product Sizes
1000 ug
£2603.00
100-275-L1000-1000UG
About this Product
- SKU:
- 100-275-L1000
- Additional Names:
- Parathyroid Hormone-related Protein
- Extra Details:
- PTHrP is a polypeptide hormone produced by almost every tissue of the body. PTHrP is closely related to parathyroid hormone (PTH), which is secreted from the parathyroid gland, and plays a central role in regulating the extracellular concentrations of calcium and phosphorous. Recombinant human PTHrP is a 9.8 kDa linear polypeptide of 86 amino acid residues.
- Formulation:
- lyophilized
- Molecular Weight:
- 9.8 kDa
- Purity:
- > 98% by SDS-PAGE & HPLC analyses
- Reactivities:
- Human
- Sequence:
- AVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATSEVSPNSKPSPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTP
- Shipping Conditions:
- Blue Ice
- Supplier:
- ReliaTech
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
