I-TAC (CXCL11) (Animal Free)
Product Sizes
5 ug
£178.00
100-058S-AF-5UG
About this Product
- SKU:
- 100-058S-AF
- Additional Names:
- CXCL11; IP9; H174; IP-9; b-R1; I-TAC; SCYB11; SCYB9B
- Extra Details:
- I-TAC is a 'non-ELR' CXC chemokine that is regulated by interferon and signals through the CXCR3 receptor. I-TAC is chemoattractant for IL-2 activated T cells, but does not affect freshly isolated un-stimulated T cells, neutrophils, ormonocytes. Recombinant Human I-TAC (CXCL11) is an 8.3 kDa protein containing 73 amino acid residues, including the four highly conserved cysteine residues present in CXC chemokines.
- Formulation:
- lyophilized
- Host:
- E. coli
- Molecular Weight:
- 8.3 kDa
- Purity:
- ≥98%
- Reactivities:
- Hamster, Human, Mouse, Non-human Primate, Rabbit
- Sequence:
- FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF
- Shipping Conditions:
- Ambient
- Storage Conditions:
- Room Temperature
- Supplier:
- ReliaTech
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
