Anti-GluA2/GluR2 Glutamate Receptor Antibody
Product Sizes
20 ul
75-002-020-20UL
About this Product
- SKU:
- 75-002-020
- Additional Names:
- Glutamate receptor 2 (GluR-2) (AMPA-selective glutamate receptor 2) (GluR-B) (GluR-K2) (Glutamate receptor ionotropic, AMPA 2) (GluA2)
- Application:
- Electron Microscopy, ELISA, Immunocytochemistry, Immunohistochemistry, Immunoprecipitation, Western Blot
- Buffer:
- 10 mM Tris, 50 mM Sodium Chloride
- CE/IVD:
- RUO
- translate.label.attr.clone:
- L21/32
- Clonality:
- Monoclonal
- Concentration:
- 1 mg/ml
- Extra Details:
- Our Anti-GluA2/GluR2 glutamate receptor mouse monoclonal primary antibody from NeuroMab is produced in-house from hybridoma clone L21/32. It is KO validated, detects human, mouse, and rat GluA2/GluR2 glutamate receptor, and is purified by Protein A chromatography. It is great for use in EM, IHC, ICC, IP, WB., AntibodiesInc
- Formulation:
- 10 mM Tris, 50 mM Sodium Chloride, 0.065% Sodium Azide pH 7.4
- Host:
- Mouse
- Immunogen:
- Fusion protein amino acids 834-883 (EFCYKSRAEAKRMKVAKNPQNINPSSSQNSQNFATYKEGYNVYGIESVKI, cytoplasmic C-terminus) of rat GluA2/GluR2 produced recombinantly in E. Coli
- Isotype:
- IgG1
- Molecular Weight:
- 90 kDa
- Physical State:
- Liquid
- Purification:
- Protein A Purified
- Reactivities:
- Human, Mouse, Rat
- Shipping Conditions:
- Blue Ice
- Specificity:
- Does not cross-react with GluA1/GluR1, GluA3/GluR3 or GluA4/GluR4 (based on KO validation results)
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles., 2-8[o]C
- Supplier:
- Antibodies Incorporated
- Type:
- Antibody: Monoclonal Antibody
