Recombinant Human IFN-gamma Protein
Product Sizes
20 ug
RP01038-20UG
50 ug
RP01038-50UG
100 ug
RP01038-100UG
About this Product
- SKU:
- RP01038
- Additional Names:
- IFNG,IFG,IFI
- Extra Details:
- Recombinant Human IFN-gamma Protein is produced by E. coli expression system. The target protein is expressed with sequence ( Gln24-Gln166) of human Interferon Gamma (Accession #NP_000610.2).
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Gln24-Gln166
- Molecular Weight:
- 16.78 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequence:
- QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ
- Shipping Conditions:
- Dry Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01038








