Recombinant Toxoplasma gondii Dense granule protein 1(GRA1) SKU: CSB-YP319538TOV Academic Pricing: Please contact us at info@2bscientific.com for specific academic pricing Additional Names: Major antigen p24 Application: WB, SDS-PAGE Buffer: Tris-based buffer,50% glycerol Extra Details: Large sizes and various expression systems are available. Gene Details: GRA1 Host: Yeast Molecular Weight: 19.9 kDa Protein Details: Tag information:N-terminal 6xHis-tagged Purity: Greater than 90% as determined by SDS-PAGE. Sequence: AEGGDNQSSAVSDRASLFGLLSGGTGQGLGIGESVDLEMMGNTYRVERPTGNPDLLKIAIKASDGSYSEVGNVNVEEVIDTMKSMQRDEDIFLRALNKGETVEEAIEDVAQAEGLNSEQTLQLEDAVSAVASVVQDEMKVIDDVQQLEKDKQQLKDDIGFLTGERE Shipping Conditions: Blue Ice Source: Toxoplasma gondii Storage Conditions: Please refer to datasheet Supplier: Cusabio-Flarebio Size: 10ug Manufacturer's Data Sheet:Recombinant-Toxoplasma-gondii-Dense-granule-protein-1GRA1-12550199.html Price for 10ug £471.00 Qty: Add to order Hi, 2B Team here, how can we make a difference? Chat