Recombinant Escherichia coli Peptidyl-prolyl cis-trans isomerase A(ppiA) Citation Available Product Size(s) 20 ug £592.00 CSB-EP360284EOD-20UG Add to order Added to order 100 ug £957.00 CSB-EP360284EOD-100UG Add to order Added to order 1 mg £2814.00 CSB-EP360284EOD-1MG Add to order Added to order Academic Pricing Please contact us for academic pricing. Contact Us About this Product SKU: CSB-EP360284EOD Additional Names: PPIase A Alternative name(s): Cyclophilin A Rotamase A Buffer: If delivery form liquid; default storage buffer Tris/PBS-based buffer, 5%-50% glycerol. If delivery form lyophilized powder; buffer before lyophilization Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Gene Details: ppiA Molecular Weight: 34.1 kDa Physical State: Liquid or Lyophilized powder Protein Details: P0AFL5 Purity: >90% Sequence: AKGDPHVLLTTSAGNIELELDKQKAPVSVQNFVDYVNSGFYNNTTFHRVIPGFMIQGGGFTEQMQQKKPNPPIKNEADNGLRNTRGTIAMARTADKDSATSQFFINVADNAFLDHGQRDFGYAVFGKVVKGMDVADKISQVPTHDVGPYQNVPSKPVVILSAKVLP Shipping Conditions: Blue Ice Specificity: Bacteria Storage Conditions: -20[o]C/-70[o]C reconstituted. Avoid freeze/thaw cycles. Supplier: Cusabio Type: Proteins, Peptides, Small Molecules & Other Biomolecules: Enzymes Manufacturer's Data Sheet:Recombinant-Peptidyl-prolyl-cis-trans-isomerase-AppiA-11431618.html Epitope Tag: 6xHIS-SUMO Tag Synonyms: Cyclophilin A;ECs_4214;peptidyl-prolyl cis-trans isomerase A;Rotamase A (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Need Help?