Recombinant Human Flt3 ligand/Flt3L Protein
Product Sizes
10 ug
RP00175-10UG
20 ug
RP00175-20UG
50 ug
RP00175-50UG
100 ug
RP00175-100UG
About this Product
- SKU:
- RP00175
- Additional Names:
- FL,FLT3L,FLT3LG,FLT3LG
- Extra Details:
- Recombinant Human Flt3 ligand/Flt3L Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Thr27-Pro185) of human FLT3L/Flt3 ligand/FLT3LG (Accession #NP_001450.2) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Thr27-Pro185
- Molecular Weight:
- 18.88 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequence:
- TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTAPQPP
- Shipping Conditions:
- Dry Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP00175
