Ang4 Recombinant Protein
Product Sizes
20 ug
OPCA03283-20UG
100 ug
OPCA03283-100UG
About this Product
- SKU:
- OPCA03283
- Additional Names:
- angiogenin-4;Raa4;ribonuclease A a4;Rna;Rnase5d.|angiogenin, ribonuclease A family, member 4
- Buffer:
- Liquid or Lyophilized powder
- Extra Details:
- Has bactericidal activity against E.faecalis and L.monocytogenes, but not against L.innocua and E.coli. Promotes angiogenesis (in vitro). Has low ribonuclease activity (in vitro). Promotes proliferation of melanoma cells, but not of endothelial cells or fibroblasts (in vitro).
- Formulation:
- Liquid or Lyophilized powder
- Immunogen:
- Ang4
- Molecular Weight:
- 29.9 kDa
- Purity:
- >90%
- Reactivities:
- Mouse
- Sequence:
- QNERYEKFLRQHYDAKPNGRDDRYCESMMKERKLTSPCKDVNTFIHGTKKNIRAICGKKGSPYGENFRISNSPFQITTCTHSGASPRPPCGYRAFKDFRYIVIACEDGWPVHFDESFISP
- Shipping Conditions:
- Blue Ice
- Source:
- Mouse
- Storage Conditions:
- -20[o]C
- Supplier:
- Aviva Systems Biology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:html_datasheet.php
