SARS-CoV-2 Spike RBD Protein, Recombinant, Biotinylated
Product Sizes
0.1 mg
COVRBD-B-301-0.1MG
About this Product
- SKU:
- COVRBD-B-301
- Application:
- Protein Engineering
- Conjugate:
- Biotin
- Extra Details:
- The coronavirus Spike protein (S protein) is a large oligomeric transmembrane protein that mediates coronavirus entry into host cells. It contains S1 and S2 subunits. Spike S1 protein contains a receptor binding domain (RBD) that recognizes a variety of host cell surface receptors including angiotensin-converting enzyme 2 (ACE2). A DNA sequence encoding the SARS-CoV-2 Spike Protein (RBD) (YP_009724390.1) (Arg319-Phe541) was expressed with a polyhistidine tag and AviTag at the N-terminus. The protein was site-specifically biotinylated at AviTag with BirA enzyme. Catalog number: COVRBD-B-301 Sequence: MGHHHHHHHHGLNDIFEAQKIEWHERVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSAS FSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLY RLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNL VKNKCVNF Expression host: Escherichia coli (E. coli). Species: SARS-CoV-2 Expressed Region of S1: Arg319-Phe541 Predicted molecular weight: ~28.5 kDa Tags: His, AviTag
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -70[o]C
- Supplier:
- Amid Biosciences
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Conjugated Protein
- Manufacturer's Data Sheet:sars-cov-2-spike-rbd-protein-recombinant-biotinylated


