Prolactin, pegylated
Product Sizes
10 ug
£301.18
500-084-10UG
50 ug
£674.12
500-084-50UG
About this Product
- SKU:
- 500-084
- Additional Names:
- Mammotropin, Luterotropic hormone, Lutetropin
- translate.label.attr.clone:
- (#3(4H3))
- Extra Details:
- Recombinant chicken prolactin, consists of one polypeptide chain containing 199 amino and an additional Ala at N-terminus acids was mono-pegylated and purified by proprietary chromatographic techniques as described by Oclon et al. (in press). Its molecular mass is ~ 39 kDa, however under non-denaturing conditions it behaves as 220 kDa protein due to its increased hydrodynamic volume.
- Formulation:
- lyophilized
- Host:
- Mouse
- Molecular Weight:
- 39.0 kDa
- Purity:
- > 99% by SDS-PAGE & HPLC analyses
- Reactivities:
- Avian
- Sequence:
- ALPICPIGSVNCQVSLGELFDRAVKLSHYIHYLSSEIFNEFDERYAQGRGFITKAVNGCHTSSLTTPEDKEQAQQIHHEDLLNLVVGVLRSWNDPLIHLASEVQRIKEAPDTILWKAVEIEEQNKRLLEGMEKIVGRVHSGDAGNEIYSHWDGLPSLQLADEDSRLFAFYNLLHCLRRDSHKIDNYLKVLKCRLIHDSNC
- Shipping Conditions:
- Ambient
- Storage Conditions:
- Room Temperature
- Supplier:
- ReliaTech
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins