Leptin A
Product Sizes
100 ug
£405.00
500-074-100UG
500 ug
£729.00
500-074-500UG
About this Product
- SKU:
- 500-074
- Additional Names:
- Lep; ob; obese
- Extra Details:
- Full-length cDNA encoding two leptin sequences (tLepA and tLepB) were identified in tilapia (Oreochromis niloticus). The cDNAs of tLepA and tLepB were 486 bp and 459 bp in length, encoding proteins of 161 aa and 152 aa, respectively. The tLepA- -expressing plasmid was transformed into E. coli and expressed as recombinant protein upon induction with nalidixic acid, found almost entirely in insoluble inclusion bodies (IBs). The protein was solubilized, refolded and purified to homogeneity by anion-exchange chromatography. More information can be found in Shpilman et al. (2014) General and Comparative Endocrinology 270, 74-85.
- Formulation:
- lyophilized
- Host:
- E. coli
- Molecular Weight:
- 15.9 kDa
- Purity:
- > 95.0% as determined by Gel filtration and SDS-PAGE gel.
- Reactivities:
- Fish
- Sequence:
- APLPVEVVTMKSKVKWMAEQLVVRLDKDVQVPVNWTLNPPADDLDGTSSIETVLNGYNSLIPDTFKGVSQIKYDISSLTGYIHLWRQGHCSEQRPKPEVPGPLQELQSHKEFIQTVGIEALMRVKEFLNLLLKNLDQLETC
- Shipping Conditions:
- Ambient
- Storage Conditions:
- Room Temperature
- Supplier:
- ReliaTech
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
