Leptin
Product Sizes
100 ug
£301.18
500-071-100UG
500 ug
£647.06
500-071-500UG
About this Product
- SKU:
- 500-071
- Additional Names:
- Lep; ob; obese
- translate.label.attr.clone:
- Rabbit IgG
- Extra Details:
- The first biologically active recombinant fish leptin was prepared according to the sequence published by Kurokawa et al. (2005)Peptides 26, 745-750 in two forms: monomer and covalent dimer. MS analysis revealed molecular masses of 15,291 and 30,585 Da, close to the theoretical values of 15,270 and 30,540 Da. CD spectra revealed high similarity to mammalian leptins. Other details of its preparation will be soon published by Yacobovitz et al , General and Comparative Endocrinology (2008) 156(1):83-90.
- Formulation:
- lyophilized
- Host:
- Rat
- Molecular Weight:
- 15.3 kDa (momnomer)
- Purity:
- > 98.0% as determined by Gel filtration and SDS-PAGE gel.
- Reactivities:
- Fish
- Sequence:
- ALPGALDAMDVEKMKSKVTWKAQGLVARIDKHFPDRGLRFDTDKVEGSTSVVASLESYNNLISDRFGGVSQIKTEISSLAGYLNHWREGNCQEQQPKVWPRRNIFNHTVSLEALMRVREFLKLLQKNVDLLERC
- Shipping Conditions:
- Ambient
- Storage Conditions:
- Room Temperature
- Supplier:
- ReliaTech
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins