Leptin pegylated antagonist (mutant L39A/D40A/F41A)
Product Sizes
50 ug
£404.71
500-066-50UG
100 ug
£674.12
500-066-100UG
About this Product
- SKU:
- 500-066
- Additional Names:
- Lep; ob; obese
- translate.label.attr.clone:
- (#14G5)
- Extra Details:
- Mono-pegylated (with 20 kDa PEG)recombinant ovine leptin antagonist is one polypeptide chain containing 146 amino, an additional Ala at N-terminus and one molecule of PEG 20 kDa at its N-terminus, having an expected molecular mass of ~ 35.6 kDa as determined by MS. However due to enlarged hydrodymanic volume it runs on the SDS-PAGE as 48 kDa protein and in gel-filtration on Superdex 200 as over 200 kDa protein. Ovine leptin was initially mutated, resulting in L39A/D40A/F41A mutant that was purified by proprietary chromatographic techniques according to Niv-Spector et al (2005) Biochemical Journal, 291, 221-230 and its pegylation was similar to that of mouse leptin antagonist is described in Elinav et al. Endocrinology (2009)150, 3083-3091.
- Formulation:
- lyophilized
- Host:
- Rabbit
- Molecular Weight:
- 35.6 kDa
- Purity:
- > 95.0% as determined by Gel filtration and SDS-PAGE gel.
- Reactivities:
- Sheep
- Sequence:
- AVPIRKVQDDTKTLIKTIVTRINDISHTQSVSSKQRVTGAAAIPGLHPLLSLSKMDQTLAIYQQILASLPSRNVIQISNDLENLRDLLHLLAASKSCPLPQVRALESLESLGVVLEASLYSTEVVALSRLQGSLQDMLRQLDLSPG
- Shipping Conditions:
- Ambient
- Storage Conditions:
- Room Temperature
- Supplier:
- ReliaTech
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins