Leptin
Product Sizes
100 ug
£301.00
500-061-100UG
500 ug
£647.00
500-061-500UG
About this Product
- SKU:
- 500-061
- Additional Names:
- Lep; ob; obese
- Extra Details:
- Recombinant horse leptin is an one polypeptide chain containing 146 amino and additional Ala at N-terminus acids and having a molecular mass of ~ 16 kDa. Recombinant horse leptin was purified by proprietary chromatographic techniques, (unpublished).
- Formulation:
- lyophilized
- Host:
- Insect/Arthropod
- Molecular Weight:
- 16.0 kDa
- Purity:
- > 99.0% as determined by Gel filtration and SDS-PAGE gel.
- Reactivities:
- Horse
- Sequence:
- AVPIRKVQDDTKTLIKTIVTRINDISHTQSVSSKQRVTGLDFIPGLHPVLSLSKMDQTLAIYQQILTSLPSRNVIQISNDLENLRDLLHLLASSKSCPLPQARGLETLASLGGVLEASLYSTEVVALSRLQGSLQDMLQQLDLSPGC
- Shipping Conditions:
- Ambient
- Storage Conditions:
- Room Temperature
- Supplier:
- ReliaTech
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
