Leptin
Product Sizes
100 ug
£301.00
500-058-100UG
500 ug
£647.00
500-058-500UG
About this Product
- SKU:
- 500-058
- Additional Names:
- Lep; ob; obese
- Extra Details:
- Recombinant chicken leptin is an one polypeptide chain containing 145 amino and additional Ala at N-terminus acids and having a molecular mass of ~ 16 kDa. Chicken leptin was prepared according to the sequence published by the groups of Taouis and McMutry, purified by proprietary chromatographic techniques, see Raver et al. Protein Expr Purif. 1998 Dec; 14(3):403-8.
- Formulation:
- lyophilized
- Host:
- E. coli
- Molecular Weight:
- 16.0 kDa
- Purity:
- > 98.0% as determined by Gel filtration and SDS-PAGE gel.
- Reactivities:
- Avian
- Sequence:
- AVPCQIFQDDTKTLIKTIVTRINDISHTSVSAKQRVTGLDFIPGLHPILSLSKMDQTLAVYQQVLTSLPSQNVLQIANDLENLRDLLHLLAFSKSCSLPQTSGLQKPESLDGVLEASLYSTEVVALSRLQGSLQDILQQLDISPEC
- Shipping Conditions:
- Ambient
- Storage Conditions:
- Room Temperature
- Supplier:
- ReliaTech
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins