Leptin N82K mutant
Product Sizes
100 ug
£277.65
500-039-100UG
500 ug
£367.06
500-039-500UG
About this Product
- SKU:
- 500-039
- Additional Names:
- Lep; ob; obese
- Extra Details:
- Recombinant protein - human leptin N82K mutant was produced by site specific mutagenesis. It consists of one polypeptide chain containing 146 amino and additional Ala at N-terminus acids and having a molecular mass of ~ 16 kDa., Human leptin mutant was purified by proprietary chromatographic techniques, see Niv-Spector et al. (2010) Mol Genet Metab. 100(2):193-7. It is devoid of biological activity and mey serve for control experiments.
- Formulation:
- lyophilized
- Host:
- E. coli
- Molecular Weight:
- 16.0 kDa
- Purity:
- > 98.0% as determined by Gel filtration and SDS-PAGE gel.
- Reactivities:
- Human
- Sequence:
- AVPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLEKLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC
- Shipping Conditions:
- Ambient
- Storage Conditions:
- Room Temperature
- Supplier:
- ReliaTech
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins