IL-22, pegylated
Product Sizes
10 ug
£412.00
500-026-10UG
50 ug
£1165.00
500-026-50UG
About this Product
- SKU:
- 500-026
- Additional Names:
- I-TIF
- translate.label.attr.clone:
- (#4G1G)
- Extra Details:
- Mono-pegylated (with 20 kDa PEG)recombinant human interleukin 22 is one polypeptide chain containing 147 amino, an additional Ala at N-terminus and one molecule of PEG 20 kDa at its N-terminus, having an expected molecular mass of ~ 36 kDa as determined by MS. However due to enlarged hydrodymanic volume it runs on the SDS-PAGE as 50 kDa protein and in gel-filtration on Superdex 200 as over 200 kDa protein. It was prepared similarly to that described by L. Niv-Spector et al. Protein Eng Des Sel. (PEDS) 25:397-404 (2012).
- Formulation:
- lyophilized
- Host:
- E. coli
- Molecular Weight:
- 36.0 kDa (monomer)
- Purity:
- > 98.0% as determined by Gel filtration and SDS-PAGE gel.
- Reactivities:
- Human
- Sequence:
- AAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI
- Shipping Conditions:
- Ambient
- Storage Conditions:
- Room Temperature
- Supplier:
- ReliaTech
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
