Growth Hormone
Product Sizes
10 ug
£277.65
500-020-10UG
50 ug
£404.71
500-020-50UG
About this Product
- SKU:
- 500-020
- Additional Names:
- Somatotropin, GH, GH-N, Growth Hormone 1, Pituitary growth hormone
- Extra Details:
- Recombinant Gilthead Seabream (Sparus aurata) growth hormone (gsGH) produced in E. coli (21.4 K) is a single, non-glycosylated, polypeptide chain containing 188 amino acids and having a molecular mass of ~ 21.392 kDa. Recombinant Gilthead Seabream growth hormone was purified by chromatographic techniques, according to Ben-Atia et al., General and Comparative Endocrinology 113, 155-164 (1999).
- Formulation:
- lyophilized
- Host:
- E. coli
- Molecular Weight:
- 21.4 kda
- Purity:
- > 98.0% as determined by Gel filtration and SDS-PAGE.
- Sequence:
- AQPITDGQRLFSIAVSRVQHLHLLAQRLFSDFESSLQTEEQRQLNKIFLQDFCNSDYIISPIDKHETQRSSVLKLLSISYRLVESWEFPSRSLSGGSAPRNQISPKLSELKTGIHLLIRANEDGAEIFPDSSALQLAPYGNYYQSLGTDESLRRTYELLACFKKDMHKVETYLTVAKCRLSPEANCTL
- Shipping Conditions:
- Ambient
- Storage Conditions:
- Room Temperature
- Supplier:
- ReliaTech
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins