Growth Hormone
Product Sizes
10 ug
£278.00
500-015-10UG
50 ug
£405.00
500-015-50UG
About this Product
- SKU:
- 500-015
- Additional Names:
- Somatotropin, GH, GH-N, Growth Hormone 1, Pituitary growth hormone
- Extra Details:
- Recombinant rabbit growth hormone (rbGH), one polypeptide chain containing 190 amino and an additional Ala at N-terminus acids and having a molecular mass of ~ 21.5 kDa
- Formulation:
- lyophilized
- Host:
- E. coli
- Molecular Weight:
- 21.5 kDa
- Purity:
- > 98.0% as determined by Gel filtration and SDS-PAGE gel.
- Sequence:
- AAFPAMPLSSLFANAVLRAQHLHQLAADTYKEFERAYIPEGQRYSIQNAQAAFCFSETIPAPTGKDEAQQRSDMELLRFSLLLIQSWLGPVQFLSRAFTNTLVFGTSDRVYEKLKDLEEGIQALMRELEDGSPRVGQLLKQTYDKFDTNLRGDDALLKNYGLLSCFKKDLHKAETYLRVMKCRRFVESSCVF
- Shipping Conditions:
- Ambient
- Storage Conditions:
- Room Temperature
- Supplier:
- ReliaTech
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins