Growth Hormone mutant (G119R)
Product Sizes
10 ug
£278.00
500-011-10UG
50 ug
£405.00
500-011-50UG
About this Product
- SKU:
- 500-011
- Additional Names:
- Somatotropin, GH, GH-N, Growth Hormone 1, Pituitary growth hormone
- Extra Details:
- Chicken recombinant growth hormone (chGH) mutein G119R produced in E.Coli (22 K) is a single, non-glycosylated, polypeptide chain containing 191 amino acids with an additional Ala at its N-terminus and having a molecular mass of 22.3 kDa. For reference see Eliasiewicz et al. (2006) Ann N Y Acad Sci. 1091:501-508.
- Formulation:
- lyophilized
- Host:
- E. coli
- Molecular Weight:
- 22.3 kda
- Purity:
- > 98.0% as determined by RP-HPLC, Gel filtration and SDS-PAGE Silver Stained gel.
- Sequence:
- ATFPAMPLSNLFANAVLRAQHLHLLAAETYKEFERTYIPEDQRYTNKNSQAAFCYSETIPAPTGKDDAQQKSDMELLRFSLVLIQSWLTPVQYLSKVFTNNLVFGTSDRVFEKLKDLEERIQALMRELEDRSPRGPQLLRPTYDKFDIHLRNEDALLKNYGLLSCFKKDLHKVETYLKVMKCRRFGESNCTI
- Shipping Conditions:
- Ambient
- Storage Conditions:
- Room Temperature
- Supplier:
- ReliaTech
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins