ADK Recombinant Protein (Shigella flexneri)
Product Sizes
20 ug
OPCA05142-20UG
100 ug
OPCA05142-100UG
1 mg
OPCA05142-1MG
About this Product
- SKU:
- OPCA05142
- Additional Names:
- adenylate kinase|Adenylate monophosphate kinase;ATP:AMP phosphotransferase;ATP-AMP transphosphorylase;SF0419.
- Buffer:
- Liquid or Lyophilized powder
- Extra Details:
- Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP. Plays an important role in cellular energy homeostasis and in adenine nucleotide metabolism.
- Formulation:
- Liquid or Lyophilized powder
- Immunogen:
- adk
- Molecular Weight:
- 43.6 kda
- Purity:
- >90%
- Reactivities:
- Bacteria
- Sequence:
- MRIILLGAPGAGKGTQAQFIMEKYGIPQISTGDMLRAAVKSGSELGKQAKDIMDAGKLVTDELVIALVKERIAQEDCRNGFLLDGFPRTIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRVHAPSGRVYHVKFNPPKVEGKDDVTGEELTTRKDDQEETVRKRLVEYHQMTAPLIGYYSKEAEAGNTKYAKVDGTKQVAEVRADLEKILG
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C
- Supplier:
- Aviva Systems Biology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:html_datasheet.php
