CFAP20 Recombinant Protein (Human)
Product Sizes
20 ug
OPCA04926-20UG
100 ug
OPCA04926-100UG
1 mg
OPCA04926-1MG
About this Product
- SKU:
- OPCA04926
- Additional Names:
- basal body up-regulated protein 22;BUG22;C16orf80;cilia- and flagella-associated protein 20;EVORF;flagellar associated protein 20 homolog;fSAP23;functional spliceosome-associated protein 23;gene trap locus 3;GTL3;transcription factor IIB;UPF0468 protein C16orf80.|cilia and flagella associated protein 20
- Buffer:
- Liquid or Lyophilized powder
- Extra Details:
- Cilium- and flagellum-specific protein that plays a role in axonemal structure organization and motility. Involved in the regulation of the size and morphology of cilia (PubMed:24414207). Required for axonemal microtubules polyglutamylation (PubMed:24414207).
- Formulation:
- Liquid or Lyophilized powder
- Immunogen:
- CFAP20
- Molecular Weight:
- 49.8 kDa
- Purity:
- >90%
- Reactivities:
- Human
- Sequence:
- MFKNTFQSGFLSILYSIGSKPLQIWDKKVRNGHIKRITDNDIQSLVLEIEGTNVSTTYITCPADPKKTLGIKLPFLVMIIKNLKKYFTFEVQVLDDKNVRRRFRASNYQSTTRVKPFICTMPMRLDDGWNQIQFNLLDFTRRAYGTNYIETLRVQIHANCRIRRVYFSDRLYSEDELPAEFKLYLPVQNKAKQ
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C
- Supplier:
- Aviva Systems Biology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:html_datasheet.php
