Protein E7 Recombinant Protein (Human)
Product Sizes
100 ug
OPCA04004-100UG
1 mg
OPCA04004-1MG
About this Product
- SKU:
- OPCA04004
- Additional Names:
- HpV16gp2;transforming protein E7.|transforming protein E7
- Buffer:
- Lyophilized PBS, 6% Trehalose (pH 7.4)
- Extra Details:
- Plays a role in viral genome replication by driving entry of quiescent cells into the cell cycle. Stimulation of progression from G1 to S phase allows the virus to efficiently use the cellular DNA replicating machinery to achieve viral genome replication. E7 protein has both transforming and trans-activating activities. Induces the disassembly of the E2F1 transcription factor from RB1, with subsequent transcriptional activation of E2F1-regulated S-phase genes. Interferes with host histone deacetylation mediated by HDAC1 and HDAC2, leading to transcription activation. Plays also a role in the inhibition of both antiviral and antiproliferative functions of host interferon alpha. Interaction with host TMEM173/STING impairs the ability of TMEM173/STING to sense cytosolic DNA and promote the production of type I interferon (IFN-alpha and IFN-beta).
- Formulation:
- Lyophilized PBS, 6% Trehalose (pH 7.4)
- Immunogen:
- E7
- Molecular Weight:
- 15 kDa
- Physical State:
- Lyophilized
- Purity:
- >90%
- Purification:
- Affinity Purified
- Reactivities:
- Virus
- Sequence:
- Full Length: MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- Aviva Systems Biology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:html_datasheet.php