Single-stranded DNA-binding gp2.5 Recombinant Protein
Product Sizes
20 ug
OPCA02962-20UG
100 ug
OPCA02962-100UG
About this Product
- SKU:
- OPCA02962
- Additional Names:
- single-stranded DNA-binding protein|single-stranded DNA-binding protein;T7p17.
- Buffer:
- Liquid or Lyophilized powder
- Extra Details:
- Single-stranded DNA-binding protein that eliminates secondary structure in long ssDNA formed on the lagging strand of the replication fork. Stimulates DNA polymerase activity and increases the efficiency of RNA primer synthesis by interacting with the DNA polymerase and the helicase/primase protein gp4. Disrupts loops, hairpins and other secondary structures present on ssDNA to reduce and eliminate pausing of viral DNA polymerase at specific sites during elongation.
- Formulation:
- Liquid or Lyophilized powder
- Immunogen:
- T7p17
- Molecular Weight:
- 25.7 kDa
- Purity:
- >90%
- Purification:
- Affinity Purified
- Reactivities:
- Virus
- Sequence:
- Full Length: MAKKIFTSALGTAEPYAYIAKPDYGNEERGFGNPRGVYKVDLTIPNKDPRCQRMVDEIVKCHEEAYAAAVEEYEANPPAVARGKKPLKPYEGDMPFFDNGDGTTTFKFKCYASFQDKKTKETKHINLVVVDSKGKKMEDVPIIGGGSKLKVKYSLVPYKWNTAVGASVKLQLESVMLVELATFGGGEDDWADEVEENGYVASGSAKASKPRDEESWDEDDEESEEADEDGDF|MAKKIFTSALGTAEPYAYIAKPDYGNEERGFGNPRGVYKVDLTIPNKDPRCQRMVDEIVKCHEEAYAAAVEEYEANPPAVARGKKPLKPYEGDMPFFDNGDGTTTFKFKCYASFQDKKTKETKHINLVVVDSKGKKMEDVPIIGGGSKLKVKYSLVPYKWNTAVGASVKLQLESVMLVELATFGGGEDDWADEVEENGYVASGSAKASKPRDEESWDEDDEESEEADEDGDF
- Shipping Conditions:
- Blue Ice
- Source:
- Enterobacteria phage T8
- Storage Conditions:
- -20[o]C
- Supplier:
- Aviva Systems Biology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:html_datasheet.php
